PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_753_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 266aa    MW: 30162.5 Da    PI: 4.5177
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_753_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665e-2166119356
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k++++t+eq++ Le+ Fe ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  Neem_753_f_2  66 KKRRLTPEQVHLLEKSFEAENKLEPERKAQLAKKLGLQPRQVAVWFQNRRARWK 119
                   5678*************************************************9 PP

2HD-ZIP_I/II124.64.5e-4065146182
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                   ekkrrl+ eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy++Lk++ydal ++ e++  
  Neem_753_f_2  65 EKKRRLTPEQVHLLEKSFEAENKLEPERKAQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDVLKSSYDALLSNYEAVVV 146
                   69************************************************************************99887654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-2148123IPR009057Homeodomain-like
PROSITE profilePS5007117.97761121IPR001356Homeobox domain
SMARTSM003892.6E-2064125IPR001356Homeobox domain
PfamPF000462.8E-1866119IPR001356Homeobox domain
CDDcd000861.82E-1966122No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2267128IPR009057Homeodomain-like
PRINTSPR000311.9E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000311.9E-6101117IPR000047Helix-turn-helix motif
PfamPF021834.4E-10121144IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEARRLFFDS SAIHGNMLFL GNGDPTFRGA RSMMNMEETS KRRLFFSSSP DDLFDDGYYD  60
EQLPEKKRRL TPEQVHLLEK SFEAENKLEP ERKAQLAKKL GLQPRQVAVW FQNRRARWKT  120
KQLERDYDVL KSSYDALLSN YEAVVVSLTE KLQAKEENKE SKSSKKTEPL LEDIANLCGL  180
QFGNKIEDRL SSGSGGSAVV DEDGPQLVVD SGDSYFGCMG PVDGIQSEED DGSEDGRSYF  240
SDVLVAAADH VDQQHEEEAL GWWVWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007031433.11e-133Homeobox-leucine zipper protein HAT5
SwissprotQ022831e-94HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A061EJ861e-133A0A061EJ86_THECC; Homeobox-leucine zipper protein HAT5
STRINGVIT_14s0066g01440.t011e-122(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88842738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-88homeobox 1